PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G177800.1.p
Common NameGLYMA_09G177800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WOX
Protein Properties Length: 322aa    MW: 36541.6 Da    PI: 7.6679
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G177800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.34.7e-223392357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         +R+++++eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Glyma.09G177800.1.p 33 SRWNPSPEQLRALEELYRRgTRTPSAEQIQHITAQLrrfgNIEGKNVFYWFQNHKARERQ 92
                         7*****************99**************************************97 PP

2Wus_type_Homeobox111.54.5e-363294365
    Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         ++RW+P+peQ++ Leely++G+rtP++e+iq+ita+L+++G+ie+kNVfyWFQN+kaRerqk+
  Glyma.09G177800.1.p 32 SSRWNPSPEQLRALEELYRRGTRTPSAEQIQHITAQLRRFGNIEGKNVFYWFQNHKARERQKR 94
                         79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003899.5E-53097IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-93392IPR009057Homeodomain-like
PfamPF000461.1E-193392IPR001356Homeobox domain
SuperFamilySSF466892.18E-123398IPR009057Homeodomain-like
CDDcd000869.58E-73494No hitNo description
PROSITE profilePS5007111.3533893IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGNDFLSQYR YHHLVAEKNK REFNGATPVV VSSRWNPSPE QLRALEELYR RGTRTPSAEQ  60
IQHITAQLRR FGNIEGKNVF YWFQNHKARE RQKRRRQMES DAEPPEKKDL AASRTVFEVE  120
RTKNWTPSTN CSTMAEESVS TQRTAKAVAA AESRTDGWLL LDEGELQQRR NLFERNATWH  180
HVMQLPCPSP SAPVTHLINT TPNASAASSS MTTTTTTVTT TRRRKMDPNL IIKTHDLSFF  240
ISPLQRENSV IYLSSSSSTS EDDNCVDESQ TLQLFPLRST GDGSSDNMMK DNETEISTSA  300
MNNANNLTTP GQFFEFLPMK E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1220225TRRRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0984091e-161BT098409.1 Soybean clone JCVI-FLGm-16H23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583454.10.0PREDICTED: WUSCHEL-related homeobox 1-like
TrEMBLA0A0R0IK130.0A0A0R0IK13_SOYBN; Uncharacterized protein
STRINGGLYMA09G30831.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Representative plantOGRP8416716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.12e-46WUSCHEL related homeobox 1